Overview

  • Product name

  • Description

    Rabbit polyclonal to FUT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human FUT3 aa 83-187.
    Sequence:

    EMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRW IWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHP PLNLS


    Database link: P21217

  • Positive control

    • WB: Rat lung tissue lysate. IHC-P: Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab235831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 42 kDa.
IHC-P 1/100 - 1/300.

Target

  • Function

    May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of Vim-2, Lewis A, Lewis B, sialyl Lewis X and Lewis X/SSEA-1 antigens. May be involved in blood group Lewis determination; Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links.
  • Tissue specificity

    Highly expressed in stomach, colon, small intestine, lung and kidney and to a lesser extent in salivary gland, bladder, uterus and liver.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 10 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-(1,3/1,4)-fucosyltransferase antibody
    • Blood group Lewis alpha-4-fucosyltransferase antibody
    • CD174 antibody
    • FT3B antibody
    • Fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group) antibody
    • Fucosyltransferase 3 antibody
    • Fucosyltransferase III antibody
    • FucT III antibody
    • FucT-III antibody
    • FUT3 antibody
    • FUT3_HUMAN antibody
    • Galactoside 3(4)-L-fucosyltransferase antibody
    • LE antibody
    • Les antibody
    • Lewis FT antibody
    see all

Images

  • Anti-FUT3 antibody (ab235831) at 1/500 dilution + Rat lung tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human small intestine tissue stained for FUT3 using ab235831 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up