Overview

  • Product name

    Anti-FUT4 antibody [6B11B4]
    See all FUT4 primary antibodies
  • Description

    Mouse monoclonal [6B11B4] to FUT4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FUT4 aa 199-302. (Expressed in E.coli).
    Sequence:

    GGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPD WPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFE SPSH


    Database link: P22083

  • Positive control

    • Jurkat cell lysate; FUT4 (AA: 199-302)-hIgGFc transfected HEK293 cell lysate; FUT4 recombinant protein.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR170435-13 are from Tissue Culture Supernatant

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6B11B4
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 59 kDa.

Target

Images

  • Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + Jurkat cell lysate

    Predicted band size: 59 kDa

  • All lanes : Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : FUT4 (Amino acids: 199-302)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 59 kDa

  • Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + FUT4 recombinant protein

    Predicted band size: 59 kDa



    Expected MWt is 37 kDa.

References

This product has been referenced in:

  • Wang A  et al. Tumor-associated macrophages promote Ezrin phosphorylation-mediated epithelial-mesenchymal transition in lung adenocarcinoma through FUT4/LeY up-regulation. Oncotarget 8:28247-28259 (2017). Read more (PubMed: 28423676) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Loading amount
100000 cells
Gel Running Conditions
Reduced Denaturing
Sample
Human Cell lysate - whole cell (MDA-MB-231 breast cancer)
Specification
MDA-MB-231 breast cancer
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Feb 13 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up