Anti-FUT4 antibody [6B11B4] (ab181461)
Key features and details
- Mouse monoclonal [6B11B4] to FUT4
- Suitable for: WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-FUT4 antibody [6B11B4]
See all FUT4 primary antibodies -
Description
Mouse monoclonal [6B11B4] to FUT4 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human FUT4 aa 199-302. (Expressed in E.coli).
Sequence:GGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPD WPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFE SPSH
Database link: P22083 -
Positive control
- Jurkat cell lysate; FUT4 (AA: 199-302)-hIgGFc transfected HEK293 cell lysate; FUT4 recombinant protein.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR170435-13 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6B11B4 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181461 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 59 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 59 kDa. |
Target
-
Function
May catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens. -
Pathway
Protein modification; protein glycosylation. -
Sequence similarities
Belongs to the glycosyltransferase 10 family. -
Cellular localization
Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi. - Information by UniProt
-
Database links
- Entrez Gene: 10690 Human
- Entrez Gene: 2526 Human
- Entrez Gene: 2527 Human
- Entrez Gene: 2528 Human
- Entrez Gene: 2529 Human
- Omim: 104230 Human
- SwissProt: P22083 Human
- SwissProt: P51993 Human
see all -
Alternative names
- 3)-fucosyltransferase antibody
- Alpha-(1 antibody
- Alpha-(1,3)-fucosyltransferase antibody
see all
Images
-
Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + Jurkat cell lysate
Predicted band size: 59 kDa -
All lanes : Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : FUT4 (Amino acids: 199-302)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 59 kDa -
Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + FUT4 recombinant protein
Predicted band size: 59 kDaExpected MWt is 37 kDa.
Datasheets and documents
-
Datasheet download
References (3)
ab181461 has been referenced in 3 publications.
- Li Y et al. MicroRNA-200b relieves LPS-induced inflammatory injury by targeting FUT4 in knee articular chondrocytes in vitro. Exp Ther Med 21:407 (2021). PubMed: 33692838
- Han H & Liu L Long noncoding RNA TUG1 regulates degradation of chondrocyte extracellular matrix via miR-320c/MMP-13 axis in osteoarthritis. Open Life Sci 16:384-394 (2021). PubMed: 33981845
- Wang A et al. Tumor-associated macrophages promote Ezrin phosphorylation-mediated epithelial-mesenchymal transition in lung adenocarcinoma through FUT4/LeY up-regulation. Oncotarget 8:28247-28259 (2017). PubMed: 28423676