Overview

  • Product name

  • Description

    Rabbit polyclonal to FUT4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse FUT4 aa 144-389. (Expressed in E.coli).
    Sequence:

    VKELHDWPPPWGARERTDKALVLRVFDDQEGAVTLTGKALETVGSRPPGQ RWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSDVFVPYGFLYSRSDPT EQPSGLGPQLARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTG PGRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLWRNAFLAGAVPVVL GPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYF


    Database link: Q11127

  • Positive control

    • IHC-P: Mouse lung, brain and kidney tissues. WB: Mouse stomach lysate; HepG2, HeLa and Jurkat cell lysates; Recombinant mouse FUT4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 49 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 10 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3)-fucosyltransferase antibody
    • Alpha-(1 antibody
    • Alpha-(1,3)-fucosyltransferase antibody
    • Alpha-3-fucosyltransferase antibody
    • ELAM-1 ligand fucosyltransferase antibody
    • ELFT antibody
    • FCT3A antibody
    • Fuc-TIV antibody
    • Fucosyltransferase 4 (Alpha (1,3) Fucosyltransferase, Myeloid-Specific antibody
    • Fucosyltransferase 4 antibody
    • Fucosyltransferase IV antibody
    • FucT-IV antibody
    • Fut4 antibody
    • FUT4_HUMAN antibody
    • FUTIV antibody
    • Galactoside 3-L-fucosyltransferase antibody
    • Lewis X antibody
    • LeX antibody
    • SSEA-1 antibody
    • Stage-Specific Embryonic Antigen 1 antibody
    see all

Images

  • Paraffin-embedded mouse lung tissue stained for CD15 using ab231561 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for CD15 using ab231561 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for CD15 using ab231561 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse brain tissue stained for CD15 using ab231561 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-FUT4 antibody (ab231561) at 2 µg/ml + Recombinant mouse CD15 protein

    Predicted band size: 49 kDa

  • Anti-FUT4 antibody (ab231561) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 49 kDa

  • Anti-FUT4 antibody (ab231561) at 2 µg/ml + Mouse stomach lysate

    Predicted band size: 49 kDa

  • Anti-FUT4 antibody (ab231561) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 49 kDa

  • Anti-FUT4 antibody (ab231561) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 49 kDa

References

ab231561 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up