Anti-FUT6 antibody (ab197289)
Key features and details
- Rabbit polyclonal to FUT6
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FUT6 antibody
See all FUT6 primary antibodies -
Description
Rabbit polyclonal to FUT6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Gorilla, Orangutan -
Immunogen
Recombinant fragment corresponding to Human FUT6 aa 103-282. Genbank: BC061700
Sequence:DAVIVHHREVMYNPSAQLPRSSRRQGQRWIWFSMESPSHCWQLKAMDGYF NLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPN SARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFKNSLHP DYITEKLWRNALEAWAVPVVLGPSRSNYER
Database link: Q6P7E6 -
Positive control
- HeLa and 7721 cell lysates. Human bladder carcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Add 200 µl of steriled distilled water -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab197289 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. | |
WB | 1/200 - 1/1000. Predicted molecular weight: 42 kDa. |
Target
-
Relevance
Enzyme involved in the biosynthesis of the E-Selectin ligand, sialyl-Lewis X. Catalyzes the transfer of fucose from GDP-beta-fucose to alpha-2,3 sialylated substrates. -
Cellular localization
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note: Membrane-bound form in trans cisternae of Golgi. -
Database links
- Entrez Gene: 493976 Chimpanzee
- Entrez Gene: 2528 Human
- Omim: 136836 Human
- SwissProt: P56434 Chimpanzee
- SwissProt: Q8HYJ6 Gorilla
- SwissProt: P51993 Human
- SwissProt: Q9GKU6 Orangutan
- Unigene: 631846 Human
-
Alternative names
- Alpha (1,3) fucosyltransferase antibody
- EC=2.4.1.65 antibody
- FCT3A antibody
see all
Images
-
All lanes : Anti-FUT6 antibody (ab197289) at 1/500 dilution
Lane 1 : HeLa cell lysate
Lane 2 : 7721 cell lysate
Predicted band size: 42 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FUT6 antibody (ab197289)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Human bladder carcinoma tissue labeling FUT6 with ab197289 at a 1/100 dilution.
Protocols
References (0)
ab197289 has not yet been referenced specifically in any publications.