Overview

  • Product name

    Anti-FUT7 antibody
  • Description

    Rabbit polyclonal to FUT7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FUT7 aa 258-342.
    Sequence:

    PRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRV RLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA


    Database link: Q11130

  • Positive control

    • U-2 OS cells.
  • General notes

    Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling FUT7 with ab220050 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up