Overview

  • Product name

    Anti-FUT9 antibody
  • Description

    Rabbit polyclonal to FUT9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human FUT9 aa 166-354. (BC036101).
    Sequence:

    VPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEI HTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGS VPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSY FNWRKDFTVNLPRFWESHACLACDHVKRHQ EYKSVGNLE


    Database link: Q9Y231

  • Positive control

    • K562 cell lysate; Human fetal stomach tissue

Properties

  • Form

    Lyophilised:Reconstitute in 200 µl sterile water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 42 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • Anti-FUT9 antibody (ab176794) at 1/500 dilution + K562 cell lysate

    Predicted band size: 42 kDa

  • Immunohistochemical staining of formalin fixed, paraffin embedded Human fetal stomach tissue labeling FUT9 with ab176794 at 1/100 dilution.

References

ab176794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
100000 cells
Gel Running Conditions
Reduced Denaturing
Sample
Human Cell lysate - whole cell (MDA-MB-231 breast cancer)
Specification
MDA-MB-231 breast cancer
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Feb 17 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up