Overview

  • Product name

  • Description

    Rabbit polyclonal to FVT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human FVT1 aa 182-308.
    Sequence:

    GFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTK PLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGM APVTSITEGLQQVVTMGLFRTIALFYL


    Database link: Q06136

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
  • Tissue specificity

    Expressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in some T-cell malignancies and PHA-stimulated lymphocytes.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Involvement in disease

    A chromosomal aberration involving KDSR is a cause of follicular lymphoma; also known as type II chronic lymphatic leukemia. Translocation t(2;18)(p11;q21) with a Ig J kappa chain region (PubMed:8417785).
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 dehydrosphinganine reductase antibody
    • 3 ketodihydrosphingosine reductase antibody
    • 3-dehydrosphinganine reductase antibody
    • 3-ketodihydrosphingosine reductase antibody
    • DHSR antibody
    • FLJ36555 antibody
    • FLJ92680 antibody
    • Follicular lymphoma variant translocation 1 antibody
    • Follicular variant translocation protein 1 antibody
    • FVT 1 antibody
    • FVT-1 antibody
    • FVT1 antibody
    • KDS reductase antibody
    • KDSR antibody
    • KDSR_HUMAN antibody
    • SDR35C1 antibody
    • Short chain dehydrogenase/reductase family 35C member 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling FVT1 with ab204055 at 1/1000 dilution.

References

ab204055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up