Overview

  • Product name

    Anti-FXC1 antibody
  • Description

    Rabbit polyclonal to FXC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FXC1 aa 1-103.
    Sequence:

    MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLH SCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSP SGS


    Database link: Q9Y5J6

  • Positive control

    • IHC-P: Human kidney and thyroid tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
  • Tissue specificity

    Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
  • Sequence similarities

    Belongs to the small Tim family.
  • Domain

    The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of FXC1/TIM10B from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fracture callus 1 homolog (rat) antibody
    • Fracture callus 1 homolog antibody
    • Fracture callus protein 1 antibody
    • FxC1 antibody
    • Mitochondrial import inner membrane translocase subunit Tim10 B antibody
    • Mitochondrial import inner membrane translocase subunit Tim9 B antibody
    • OTTHUMP00000164584 antibody
    • OTTHUMP00000230720 antibody
    • TIM 10B antibody
    • Tim10b antibody
    • Tim9b antibody
    • TIM9B_HUMAN antibody
    • TIMM10B antibody
    • Translocase of inner mitochondrial membrane 10 homolog B (yeast) antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for FXC1 using ab230355 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for FXC1 using ab230355 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FXC1 (green) using ab230355 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab230355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up