Overview

  • Product name
  • Description
    Rabbit polyclonal to FXR1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human FXR1 aa 372-421 (C terminal). The exact sequence is proprietary. Numbering is based off mature sequence.
    Sequence:

    EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW


    Database link: P51114

  • Positive control
    • HepG2 Cell Lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab50841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 65 kDa (predicted molecular weight: 68 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

IHC-P Use at an assay dependent concentration.

Target

Images

  • All lanes : Anti-FXR1 antibody (ab50841) at 0.5 µg/ml

    Lane 1 : MW ladder
    Lane 2 : HepG2 Cell Lysate at 10 µg

    Secondary
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 68 kDa
    Observed band size: 68 kDa

References

This product has been referenced in:
  • Nordio L  et al. Immunohistochemical Expression of FXR1 in Canine Normal Tissues and Melanomas. J Histochem Cytochem N/A:22155418766292 (2018). Read more (PubMed: 29608406) »
  • Tarallo R  et al. The nuclear receptor ERß engages AGO2 in regulation of gene transcription, RNA splicing and RISC loading. Genome Biol 18:189 (2017). WB ; Human . Read more (PubMed: 29017520) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab50841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up