Overview

  • Product name
  • Description
    Rabbit polyclonal to FYCO1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FYCO1 aa 1102-1187.
    Sequence:

    IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDAL WQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS


    Database link: Q9BQS8

  • Positive control
    • IHC-P: Human liver tissue. ICC/IF: U-2 OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity
    Expressed in heart and skeletal muscle.
  • Sequence similarities
    Contains 1 FYVE-type zinc finger.
    Contains 1 GOLD domain.
    Contains 1 RUN domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links
  • Alternative names
    • CATC2 antibody
    • CTRCT18 antibody
    • DKFZp779K1152 antibody
    • FLJ13335 antibody
    • FYCO1 antibody
    • FYCO1_HUMAN antibody
    • FYVE and coiled coil domain containing 1 antibody
    • FYVE and coiled coil domain containing protein 1 antibody
    • FYVE and coiled-coil domain-containing protein 1 antibody
    • MGC126517 antibody
    • MGC126519 antibody
    • RUFY3 antibody
    • RUN and FYVE domain containing 3 antibody
    • ZFYVE7 antibody
    • Zinc finger FYVE domain containing protein 7 antibody
    • Zinc finger FYVE domain-containing protein 7 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for FYCO1 using ab224152 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for FYCO1 (green) using ab224152 at 4 µg/ml in ICC/IF.

References

ab224152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up