Overview

  • Product name
  • Description
    Rabbit polyclonal to G-6-Pase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Sheep, Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human G-6-Pase aa 72-121 (N terminal).
    Sequence:

    NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM


    Database link: NP_000142

  • Positive control
    • Fetal lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab83690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 40 kDa (predicted molecular weight: 40 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in G6PC are the cause of glycogen storage disease type 1A (GSD1A) [MIM:232200]. A metabolic disorder characterized by impairment of terminal steps of glycogenolysis and gluconeogenesis. Patients manifest a wide range of clinical symptoms and biochemical abnormalities, including hypoglycemia, severe hepatomegaly due to excessive accumulation of glycogen, kidney enlargement, growth retardation, lactic acidemia, hyperlipidemia, and hyperuricemia.
  • Sequence similarities
    Belongs to the glucose-6-phosphatase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AW107337 antibody
    • G-6-Pase antibody
    • G6Pase antibody
    • G6Pase-alpha antibody
    • g6pc antibody
    • G6PC_HUMAN antibody
    • G6PT antibody
    • Glucose-6-phosphatase alpha antibody
    • Glucose-6-phosphatase antibody
    • glucose-6-phosphatase, catalytic subunit antibody
    • GSD1 antibody
    • GSD1a antibody
    • MGC163350 antibody
    • MGC93613 antibody
    • RP23-281C18.19 antibody
    see all

Images

  • Anti-G-6-Pase antibody (ab83690) at 1 µg/ml + Fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 40 kDa
    Observed band size: 40 kDa

  • ab83690 at 5 µg/ml staining G-6-Pase in Human breast tissue by Immunohistochemistry (Formalin/PFA-fixed, paraffin-embedded sections).

  • ab83690 at 5 µg/ml staining G-6-Pase in Human kidney tissue by Immunohistochemistry (Formalin/PFA-fixed, paraffin-embedded sections).

  • ab83690 at 5 µg/ml staining G-6-Pase in Human liver tissue by Immunohistochemistry (Formalin/PFA-fixed, paraffin-embedded sections).

  • Anti-G-6-Pase antibody (ab83690) at 1/2000 dilution + Pig liver tissue whole cell lysate at 30 µg

    Secondary
    IRDye® 800CW-conjugated goat anti-rabbit IgG polyclonal at 1/30000 dilution

    Performed under reducing conditions.

    Predicted band size: 40 kDa
    Observed band size: 41 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 52 kDa (possible non-specific binding)


    Exposure time: 5 minutes

    See Abreview

References

This product has been referenced in:
  • Kinyua AW  et al. 4-hydroxy-3-methoxycinnamic acid regulates orexigenic peptides and hepatic glucose homeostasis through phosphorylation of FoxO1. Exp Mol Med 50:e437 (2018). WB ; Mouse . Read more (PubMed: 29391540) »
  • Zhang N  et al. Elevated hepatic expression of H19 long noncoding RNA contributes to diabetic hyperglycemia. JCI Insight 3:N/A (2018). Read more (PubMed: 29769440) »
See all 17 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-5 of 5 Abreviews

Application
Western blot
Sample
Human Cell lysate - whole cell (MDA-MB-231 cells)
Gel Running Conditions
Reduced Denaturing (4-20% TG gels)
Loading amount
50 µg
Specification
MDA-MB-231 cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Mar 02 2018

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Liver)
Gel Running Conditions
Reduced Denaturing (4-20)
Loading amount
30 µg
Specification
Liver
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 25°C

Kasia Kalemba

Verified customer

Submitted Sep 13 2017

Application
Western blot
Sample
Pig Tissue lysate - whole (Liver)
Gel Running Conditions
Reduced Denaturing (10% 37.5:1)
Loading amount
30 µg
Specification
Liver
Blocking step
hermo Starting Block 37542 as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jul 15 2014

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Sheep Tissue lysate - whole (Maternal and Fetal Liver)
Gel Running Conditions
Reduced Denaturing (10% Tris/Glycine-SDS)
Loading amount
100 µg
Specification
Maternal and Fetal Liver
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. Rob Cordery-Cotter

Verified customer

Submitted Nov 20 2012

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Liver)
Gel Running Conditions
Reduced Denaturing (10-20)
Loading amount
50 µg
Specification
Liver
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. R Berahovich

Verified customer

Submitted Dec 16 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up