Overview

  • Product name

  • Description

    Rabbit polyclonal to G-CSF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Pig G-CSF aa 34-193. (Expressed in E.coli).
    Sequence:

    FLLKCLEQVRKIQADGAELQERLCATHKLCHPQELVLLGHSLGLPQASLS SCSSQALQLTGCLNQLHGGLVLYQGLLQALAGISPELAPALDILQLDVTD LATNIWLQMEDLRMAPASLPTQGTVPTFTSAFQRRAGGVLVVSQLQSFLE LAYRVLRYLA


    Database link: O02837

  • Positive control

    • WB: Human leukocyte cell lysate; Mouse lymphocyte cell lysate: Mouse thymus tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications

    O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C17orf33 antibody
    • Colony stimulating factor 3 (granulocyte) antibody
    • Colony stimulating factor 3 antibody
    • CSF 3 antibody
    • CSF beta antibody
    • CSF3 antibody
    • CSF3_HUMAN antibody
    • CSF3OS antibody
    • Csfg antibody
    • Filgrastim antibody
    • G-CSF antibody
    • GCSA antibody
    • GCSF antibody
    • Granulocyte colony stimulating factor antibody
    • Granulocyte colony-stimulating factor antibody
    • Lenograstim antibody
    • Macrophage granulocyte inducer 2 antibody
    • MGC45931 antibody
    • MGI 2 antibody
    • Pluripoietin antibody
    see all

Images

  • All lanes : Anti-G-CSF antibody (ab231277) at 2 µg/ml

    Lane 1 : Mouse lymphocyte cells
    Lane 2 : Human leukocyte cells
    Lane 3 : Mouse thymus tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab. at 1/2000 dilution

    Predicted band size: 22 kDa

  • Anti-G-CSF antibody (ab231277) at 2 µg/ml + Recombinant pig G-SCF protein.

    Predicted band size: 22 kDa

References

ab231277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up