Overview

  • Product name

    Anti-G0/G1switch 2/G0S2 antibody
    See all G0/G1switch 2/G0S2 primary antibodies
  • Description

    Mouse polyclonal to G0/G1switch 2/G0S2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human G0/G1switch 2/G0S2 aa 1-103. (AAH09694)
    Sequence:

    METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPF TAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ HAS

  • Positive control

    • G0/G1switch 2/G0S2 transfected 293T cell line lysate
  • General notes

     This product was previously labelled as G0/G1switch 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab167178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 11 kDa.

Target

Images

  • All lanes : Anti-G0/G1switch 2/G0S2 antibody (ab167178) at 1 µg/ml

    Lane 1 : G0/G1switch 2/G0S2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Predicted band size: 11 kDa

References

ab167178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up