Overview

  • Product name

  • Description

    Rabbit polyclonal to G5PR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human G5PR aa 11-123.
    Sequence:

    LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPP MIGEEAMINYENF


    Database link: Q969Q6

  • Positive control

    • ICC/IF: SiHa cells.
  • General notes

    Previously labelled as PPP2R3C. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells.
  • Tissue specificity

    Ubiquitously expressed in brain and other tissues.
  • Sequence similarities

    Contains 2 EF-hand domains.
  • Developmental stage

    Expressed in fetal brain.
  • Cellular localization

    Nucleus. Cytoplasm. Excluded from the nucleoli. Localization is cell cycle-dependent. Localizes to the cytoplasm during cytokinesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf10 antibody
    • Chromosome 14 open reading frame 10 antibody
    • G4-1 antibody
    • G5pr antibody
    • Hypothetical protein FLJ20644 antibody
    • P2R3C_HUMAN antibody
    • ppp2r3c antibody
    • protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma antibody
    • Protein phosphatase 2 regulatory subunit B''gamma antibody
    • protein phosphatase 2, regulatory subunit B'', gamma antibody
    • Protein phosphatase subunit G5PR antibody
    • rhabdomyosarcoma antigen MU-RMS-40.6A antibody
    • Rhabdomyosarcoma antigen MU-RMS-40.6A/6C antibody
    • rhabdomyosarcoma antigen Mu-RMS-40.6C antibody
    • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for G5PR (green) using ab222311 at 4 µg/ml in ICC/IF.

References

ab222311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up