Overview

  • Product name

    Anti-GAB2 (phospho S159) antibody
    See all GAB2 primary antibodies
  • Description

    Rabbit polyclonal to GAB2 (phospho S159)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human GAB2 aa 130-170 (phospho S159) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    NVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLF


    Database link: Q9UQC2

  • Positive control

    • Mouse embryo and Rat intestine lysates; Human lung tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab203635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Use at 1/50 - 1/200 with fluorescent detection methods.

WB 1/100 - 1/1000. Predicted molecular weight: 74 kDa.

Target

  • Function

    Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF11A/RANK signaling. In allergic response, it plays a role in mast cells activation and degranulation through PI-3-kinase regulation. Also involved in the regulation of cell proliferation and hematopoiesis.
  • Sequence similarities

    Belongs to the GAB family.
    Contains 1 PH domain.
  • Domain

    The SH3-binding motifs mediate interaction with SHC1 and GRB2.
    The PH domain mediates phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,4-bisphosphate binding.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residue(s) by the thrombopoietin receptor (TPOR), stem cell factor receptor (SCFR), and T-cell and B-cell antigen receptors, gp130, IL-2R and IL-3R (By similarity). Phosphorylated upon stimulation of TNFRSF11A/RANK by TNFSF11/RANKL (By similarity). Phosphorylated upon EGF stimulation. Phosphorylated on tyrosine residues by HCK upon IL6 signaling.
    Dephosphorylated by PTPN11.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GAB 2 antibody
    • Gab2 antibody
    • GAB2_HUMAN antibody
    • Grb 2 associated binder 2 antibody
    • GRB 2 associated binding protein 2 antibody
    • Grb2 associated binder 2 antibody
    • GRB2 associated binder 2 pp100 antibody
    • GRB2 associated binding protein 2 antibody
    • GRB2-associated binder 2 antibody
    • GRB2-associated-binding protein 2 antibody
    • Growth factor receptor bound protein 2 associated protein 2 antibody
    • Growth factor receptor bound protein 2-associated protein 2 antibody
    • KIAA0571 antibody
    • p97 antibody
    • PH domain containing adaptor molecule p97 antibody
    • pp100 antibody
    see all

Images

  • All lanes : Anti-GAB2 (phospho S159) antibody (ab203635) at 1/200 dilution

    Lane 1 : Mouse embryo lysate
    Lane 2 : Rat intestine lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 74 kDa



    12% Gel.

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Human lung tissue labeling GAB2 with ab203635 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up