Overview

  • Product name

    Anti-GAB2 (phospho Y452) antibody
    See all GAB2 primary antibodies
  • Description

    Rabbit polyclonal to GAB2 (phospho Y452)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human GAB2 aa 430-470 (phospho Y452) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    VGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGD


    Database link: Q9UQC2

  • Positive control

    • Rat intestine and mouse embryo lysates; Human lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

WB 1/100 - 1/1000. Predicted molecular weight: 74 kDa.

Target

  • Function

    Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF11A/RANK signaling. In allergic response, it plays a role in mast cells activation and degranulation through PI-3-kinase regulation. Also involved in the regulation of cell proliferation and hematopoiesis.
  • Sequence similarities

    Belongs to the GAB family.
    Contains 1 PH domain.
  • Domain

    The SH3-binding motifs mediate interaction with SHC1 and GRB2.
    The PH domain mediates phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,4-bisphosphate binding.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residue(s) by the thrombopoietin receptor (TPOR), stem cell factor receptor (SCFR), and T-cell and B-cell antigen receptors, gp130, IL-2R and IL-3R (By similarity). Phosphorylated upon stimulation of TNFRSF11A/RANK by TNFSF11/RANKL (By similarity). Phosphorylated upon EGF stimulation. Phosphorylated on tyrosine residues by HCK upon IL6 signaling.
    Dephosphorylated by PTPN11.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GAB 2 antibody
    • Gab2 antibody
    • GAB2_HUMAN antibody
    • Grb 2 associated binder 2 antibody
    • GRB 2 associated binding protein 2 antibody
    • Grb2 associated binder 2 antibody
    • GRB2 associated binder 2 pp100 antibody
    • GRB2 associated binding protein 2 antibody
    • GRB2-associated binder 2 antibody
    • GRB2-associated-binding protein 2 antibody
    • Growth factor receptor bound protein 2 associated protein 2 antibody
    • Growth factor receptor bound protein 2-associated protein 2 antibody
    • KIAA0571 antibody
    • p97 antibody
    • PH domain containing adaptor molecule p97 antibody
    • pp100 antibody
    see all

Images

  • All lanes : Anti-GAB2 (phospho Y452) antibody (ab203616) at 1/200 dilution

    Lane 1 : Rat intestine lysate
    Lane 2 : Mouse embryo lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 74 kDa
    Observed band size: 80, 85 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human lung tissue labeling GAB2 with ab203616 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab203616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up