Overview

  • Product name

    Anti-GABA A Receptor alpha 3/GABRA3 antibody
    See all GABA A Receptor alpha 3/GABRA3 primary antibodies
  • Description

    Rabbit polyclonal to GABA A Receptor alpha 3/GABRA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human GABA A Receptor alpha 3/GABRA3 aa 6-125.
    Sequence:

    TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPD IPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPV SDTDMEYTIDVFFRQTWHDE


    Database link: P34903

  • Positive control

    • WB: U-87 MG and NIH/3T3 cell lysates. IHC-P: Human cerebral cortex and duodenum tissues; Mouse ventral pallidum, olfactory bulb, insular cortex and thalamus tissues.
  • General notes

     This product was previously labelled as GABA A Receptor alpha 3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 55 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA3 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GABA A Receptor alpha 3 antibody
    • GABA(A) receptor subunit alpha 3 antibody
    • GABA(A) receptor subunit alpha-3 antibody
    • GABR A3 antibody
    • GABRA 3 antibody
    • Gabra3 antibody
    • Gamma aminobutyric acid (GABA) A receptor alpha 3 antibody
    • Gamma aminobutyric acid A receptor alpha 3 antibody
    • Gamma aminobutyric acid receptor subunit alpha 3 antibody
    • Gamma-aminobutyric acid receptor subunit alpha-3 antibody
    • GBRA3_HUMAN antibody
    • MGC33793 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse ventral pallidum tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse olfactory bulb tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse insular cortex tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse thalamus tissue stained for GABA A Receptor alpha 3/GABRA3 using ab224214 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Anti-GABA A Receptor alpha 3/GABRA3 antibody (ab224214) at 1/250 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 55 kDa

  • All lanes : Anti-GABA A Receptor alpha 3/GABRA3 antibody (ab224214) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 55 kDa

References

ab224214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up