Overview

  • Product name

    Anti-GABA A Receptor alpha 3/GABRA3 antibody
    See all GABA A Receptor alpha 3/GABRA3 primary antibodies
  • Description

    Rabbit polyclonal to GABA A Receptor alpha 3/GABRA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human GABA A Receptor alpha 3/GABRA3 aa 28-74 (N terminal).
    Sequence:

    GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL

  • Positive control

    • Jurkat, HepG2, or Raji cell lysates.
  • General notes

     This product was previously labelled as GABA A Receptor alpha 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab23334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 58 kDa (predicted molecular weight: 55 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

Images

  • Mouse bulbus
  • All lanes : Anti-GABA A Receptor alpha 3/GABRA3 antibody (ab23334) at 1 µg/ml

    Lane 1 : Jurkat Cell lysate
    Lane 2 : HepG2 Cell lysate
    Lane 3 : GABRA3 Cell lysate

    Predicted band size: 55 kDa
    Observed band size: 58 kDa
    why is the actual band size different from the predicted?



    HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as second antibody.

References

ab23334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab23334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up