Overview

  • Product name
    Anti-GABA A Receptor alpha 5 antibody
    See all GABA A Receptor alpha 5 primary antibodies
  • Description
    Rabbit polyclonal to GABA A Receptor alpha 5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, IHC-Fr, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Mouse GABA A Receptor alpha 5 aa 180-229 (internal sequence). The exact sequence is proprietary. Numbering is based off mature sequence
    Sequence:

    WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK


    Database link: Q8BHJ7
    (Peptide available as ab137922)

  • Positive control
    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. Mouse muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab10098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration. Positive result against immunising peptide.
WB 1/1000. Detects a band of approximately 52 kDa (predicted molecular weight: 55.4 kDa).Can be blocked with GABA A Receptor alpha 5 peptide (ab137922). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr Use at an assay dependent concentration.
ICC/IF Use a concentration of 5 µg/ml.

Target

  • Function
    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA5 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GAA 5 antibody
    • GAA5 antibody
    • GABA(A) receptor subunit alpha-5 antibody
    • GABRA 5 antibody
    • Gabra5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 precursor antibody
    • Gamma aminobutyric acid receptor alpha 5 subunit precursor GABA A receptor antibody
    • Gamma-aminobutyric acid receptor subunit alpha-5 antibody
    • GBRA5_HUMAN antibody
    • GC138184 antibody
    see all

Images

  • Predicted band size: 55.4 kDa
    Observed band size: 52 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 40 kDa (possible non-specific binding)

  • All lanes : Anti-GABA A Receptor alpha 5 antibody (ab10098) at 1/1000 dilution

    All lanes : Mouse brain lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : IRDye® 680LT-conjugated donkey anti-rabbit IgG polyclonal (undiluted)

    Performed under reducing conditions.

    Predicted band size: 55.4 kDa
    Observed band size: 53 kDa why is the actual band size different from the predicted?


    Exposure time: 6 minutes

    See Abreview

  • ICC/IF image of ab10098 stained SHSY5Y cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab10098, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • ab10098 staining GABA A Receptor alpha 5 in rat hippocampus sections by Immunohistochemistry (Frozen sections).
    Rats were transcardially perfused with 4% PFA, the brain was cryoprotected in 30% sucrose before flash freezing. Coronal sections were taken using cryostat (20 micron sections) and mounted onto slides. Tissue was fixed in paraformaldehyde and permeabilized with 0.1% Triton X-100. Samples were then blocked using 10% serum for 1 hour at 20°C and then incubated with ab10098 at a 1/200 dilution for 16 hours at 4°C. The secondary used was an Alexa Fluor® 594 goat anti-rabbit IgG (H+L) used at a 1/600 dilution.

    An antigen retrieval step improved results (5% SDS for 5 minutes before standard IHC protocol).

    See Abreview

  • Anti-GABA A Receptor alpha 5 antibody (ab10098) at 1 µg/ml + Mouse Liver Lysate

    Predicted band size: 55.4 kDa

References

This product has been referenced in:
  • Hu D  et al. Bumetanide treatment during early development rescues maternal separation-induced susceptibility to stress. Sci Rep 7:11878 (2017). Read more (PubMed: 28928398) »
  • Modi KK  et al. Cinnamon Converts Poor Learning Mice to Good Learners: Implications for Memory Improvement. J Neuroimmune Pharmacol 11:693-707 (2016). Read more (PubMed: 27342118) »
See all 8 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-4 of 4 Abreviews

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (Brain)
Antigen retrieval step
None
Permeabilization
No
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
Fixative
Paraformaldehyde

Mrs. Olga Cravetchi

Verified customer

Submitted Jul 12 2016

Application
Western blot
Loading amount
40 µg
Gel Running Conditions
Reduced Denaturing (8%)
Sample
Mouse Cell lysate - other (Brain)
Specification
Brain
Blocking step
LI-COR Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Jan 22 2015

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (brain)
Specification
brain
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer
Permeabilization
No
Blocking step
superblock (fisher) as blocking agent for 30 minute(s) · Concentration: 100%

Abcam user community

Verified customer

Submitted Oct 04 2011

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (Brain (hippocampus))
Specification
Brain (hippocampus)
Fixative
Paraformaldehyde
Permeabilization
Yes - 5% SDS, 0.1% Triton-X 100
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C

Ms. Tara Stewart

Verified customer

Submitted Jun 17 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up