Anti-GABA A Receptor alpha 5 antibody (ab10098)

Overview

  • Product name
    Anti-GABA A Receptor alpha 5 antibody
    See all GABA A Receptor alpha 5 primary antibodies
  • Description
    Rabbit polyclonal to GABA A Receptor alpha 5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, IHC-Fr, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Mouse GABA A Receptor alpha 5 aa 180-229 (internal sequence). The exact sequence is proprietary. Numbering is based off mature sequence
    Sequence:

    WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK


    Database link: Q8BHJ7
    (Peptide available as ab137922)

  • Positive control
    • Mouse muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab10098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration. Positive result against immunising peptide.
WB 1/1000. Detects a band of approximately 52 kDa (predicted molecular weight: 55.4 kDa).Can be blocked with GABA A Receptor alpha 5 peptide (ab137922). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-Fr Use at an assay dependent concentration.
ICC/IF Use a concentration of 5 µg/ml.

Target

  • Function
    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA5 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GAA 5 antibody
    • GAA5 antibody
    • GABA(A) receptor subunit alpha-5 antibody
    • GABRA 5 antibody
    • Gabra5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 precursor antibody
    • Gamma aminobutyric acid receptor alpha 5 subunit precursor GABA A receptor antibody
    • Gamma-aminobutyric acid receptor subunit alpha-5 antibody
    • GBRA5_HUMAN antibody
    • GC138184 antibody
    see all

Images

  • Predicted band size: 55.4 kDa
    Observed band size: 52 kDa (why is the actual band size different from the predicted?)
    Additional bands at: 40 kDa (possible non-specific binding)

  • All lanes : Anti-GABA A Receptor alpha 5 antibody (ab10098) at 1/1000 dilution

    All lanes : Mouse brain lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : IRDye® 680LT-conjugated donkey anti-rabbit IgG polyclonal (undiluted)

    Performed under reducing conditions.

    Predicted band size: 55.4 kDa
    Observed band size: 53 kDa (why is the actual band size different from the predicted?)


    Exposure time: 6 minutes

    See Abreview

  • ICC/IF image of ab10098 stained SHSY5Y cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab10098, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • ab10098 staining GABA A Receptor alpha 5 in rat hippocampus sections by Immunohistochemistry (Frozen sections).
    Rats were transcardially perfused with 4% PFA, the brain was cryoprotected in 30% sucrose before flash freezing. Coronal sections were taken using cryostat (20 micron sections) and mounted onto slides. Tissue was fixed in paraformaldehyde and permeabilized with 0.1% Triton X-100. Samples were then blocked using 10% serum for 1 hour at 20°C and then incubated with ab10098 at a 1/200 dilution for 16 hours at 4°C. The secondary used was an Alexa Fluor® 594 goat anti-rabbit IgG (H+L) used at a 1/600 dilution.

    An antigen retrieval step improved results (5% SDS for 5 minutes before standard IHC protocol).

    See Abreview

  • Anti-GABA A Receptor alpha 5 antibody (ab10098) at 1 µg/ml + Mouse Liver Lysate

    Predicted band size: 55.4 kDa

References

This product has been referenced in:
  • Hu D  et al. Bumetanide treatment during early development rescues maternal separation-induced susceptibility to stress. Sci Rep 7:11878 (2017). Read more (PubMed: 28928398) »
  • Kaneko Y  et al. Oxytocin modulates GABAAR subunits to confer neuroprotection in stroke in vitro. Sci Rep 6:35659 (2016). WB ; Rat . Read more (PubMed: 27767042) »

See all 7 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (Brain)
Antigen retrieval step
None
Permeabilization
No
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
Fixative
Paraformaldehyde
Username

Mrs. Olga Cravetchi

Verified customer

Submitted Jul 12 2016

Application
Western blot
Loading amount
40 µg
Gel Running Conditions
Reduced Denaturing (8%)
Sample
Mouse Cell lysate - other (Brain)
Specification
Brain
Blocking step
LI-COR Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 23°C
Username

Abcam user community

Verified customer

Submitted Jan 22 2015

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (brain)
Specification
brain
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer
Permeabilization
No
Blocking step
superblock (fisher) as blocking agent for 30 minute(s) · Concentration: 100%
Username

Abcam user community

Verified customer

Submitted Oct 04 2011

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (Brain (hippocampus))
Specification
Brain (hippocampus)
Fixative
Paraformaldehyde
Permeabilization
Yes - 5% SDS, 0.1% Triton-X 100
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Username

Ms. Tara Stewart

Verified customer

Submitted Jun 17 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up