Overview

  • Product name

    Anti-GABA A Receptor alpha 5/GABRA5 antibody [S415-24]
    See all GABA A Receptor alpha 5/GABRA5 primary antibodies
  • Description

    Mouse monoclonal [S415-24] to GABA A Receptor alpha 5/GABRA5
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Fusion protein corresponding to Human GABA A Receptor alpha 5/GABRA5 aa 368-419. Last cytoplasmic domain before extracellular C-terminus.
    Sequence:

    VILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKK TY


    Database link: P31644

  • Positive control

    • WB: Mouse brain tissue lysate. ICC/IF: SK-N-BE cells.
  • General notes

     This product was previously labelled as GABA A Receptor alpha 5

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.1% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    S415-24
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab242001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 52 kDa.
ICC/IF 1/100.

Target

  • Function

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRA5 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GAA 5 antibody
    • GAA5 antibody
    • GABA(A) receptor subunit alpha-5 antibody
    • GABRA 5 antibody
    • Gabra5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 antibody
    • Gamma aminobutyric acid GABA A receptor alpha 5 precursor antibody
    • Gamma aminobutyric acid receptor alpha 5 subunit precursor GABA A receptor antibody
    • Gamma-aminobutyric acid receptor subunit alpha-5 antibody
    • GBRA5_HUMAN antibody
    • GC138184 antibody
    see all

Images

  • 4% formaldehyde-fixed SK-N-BE (human neuroblastoma cell line) cells stained for GABA A Receptor alpha 5/GABRA5 (green, C) using ab242001 at 1/100 dilution for 1 hour at room temperature in ICC/IF. Secondary antibody is Goat Anti-Mouse ATTO 488 at 1/100 dilution for 60 min at RT. Actin is detected with Phalloidin Texas Red F-Actin stain (red, B). The nuclear counterstain is DAPI (blue, A). (D) is a composite image.

  • Anti-GABA A Receptor alpha 5/GABRA5 antibody [S415-24] (ab242001) at 1/1000 dilution + Mouse brain tissue lysate at 20 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/200 dilution

    Predicted band size: 52 kDa



    Primary incubation for 16 hours at 4°C.

    Secondary incubation for 1 hr at RT.

References

ab242001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up