Overview

  • Product name
    Anti-GABA A Receptor beta 3/GABRB3 antibody [N87/25]
    See all GABA A Receptor beta 3/GABRB3 primary antibodies
  • Description
    Mouse monoclonal [N87/25] to GABA A Receptor beta 3/GABRB3
  • Host species
    Mouse
  • Specificity
    Does not cross react with GABA A Receptor Beta 2 or Beta 1.
  • Tested applications
    Suitable for: IHC-Fr, ICC/IF, Flow Cyt, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Fusion protein corresponding to Mouse GABA A Receptor beta 3/GABRB3 aa 370-433.
    Sequence:

    APMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDR SIPHKKTHLRRRSS

  • Positive control
    • WB: Rat brain lysate. Flow Cyt: SH-SY5Y cells. IHC-P: Mouse brain tissue.
  • General notes

    The clone number has been updated from S87-25 to N87/25, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab98968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/1000.
ICC/IF 1/100.
Flow Cyt Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

IHC-P 1/1000.
WB 1/1000. Predicted molecular weight: 55 kDa.

Sufficient for detection of GABA A Receptor beta 3/GABRB3 in 10µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Target

  • Function
    Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.
  • Involvement in disease
    Epilepsy, childhood absence 5
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily.
  • Cellular localization
    Cell junction, synapse, postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ECA5 antibody
    • GABA alpha receptor beta-2 subunit antibody
    • GABA(A) receptor subunit beta-3 antibody
    • GABAA receptor beta 3 subunit antibody
    • GABAA receptor subunit beta 3 antibody
    • GABR B3 antibody
    • Gabrb3 antibody
    • Gamma aminobutyric acid (GABA) A receptor beta 3 antibody
    • Gamma aminobutyric acid receptor subunit beta 3 antibody
    • Gamma-aminobutyric acid receptor subunit beta-3 antibody
    • GBRB3_HUMAN antibody
    • MGC9051 antibody
    see all

Images

  • Anti-GABA A Receptor beta 3/GABRB3 antibody [N87/25] (ab98968) at 1/1000 dilution + Rat brain membrane lysate at 15 µg

    Secondary
    Sheep Anti-Mouse IgG: HRP

    Predicted band size: 55 kDa



    Block: 1.5% BSA for 30 minutes at RT.

    Incubation with primary antibody for 2 hours at RT.

    Incubation with secondary antibody for 1 hour at RT.

  • ab98968 staining GABA A Receptor beta 3/GABRB3 in mouse brain tissue sections by Immunohistochemistry (IHC-Fr - frozen sections).

    Tissue was fixed in 10% formalin for 12-24 hours at RT. Primary Antibody: ab98968 at 1:1000 for 1 hour at RT. Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 µl for 5 minutes at RT.

  • Overlay histogram showing SH-SY5Y (Human neuroblastoma cell line from bone marrow) cells stained with ab98968 (red line).

    The cells were fixed with 4% paraformaldehyde (10 minutes) and then permeabilized with 0.1% PBS-Tween for 20 minutes. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab98968, 1µg/1x106 cells) for 30 minutes at 22ºC.

    The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 minutes at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions.

    Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 minutes)/permeabilized with 0.1% PBS-Tween for 20 minutes used under the same conditions.

References

This product has been referenced in:
  • Urraca N  et al. Significant transcriptional changes in 15q duplication but not Angelman syndrome deletion stem cell-derived neurons. Mol Autism 9:6 (2018). WB . Read more (PubMed: 29423132) »
  • Menzikov SA & Morozov SG Involvement of brain GABAAR-coupled Cl-/HCO3--ATPase in phenol-induced the head-twitching and tremor responses in rats. Neurotoxicology 71:122-131 (2018). Read more (PubMed: 30590068) »
See all 6 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

According to uniprot (link below) there are four isoforms of GabaA Beta3, all of which ab98968 is capable of detecting. Isoforms 1 and 2 are ˜54 kDa, isoform 3 is 47 kDa, and isoform 4 is 45 kDa. Since GabaA Beta3 is glycosylated, I would suspect the stronger, higher band is isoform 1/2 and the lower more faint band corresponds to isoforms 3 or 4.

http://www.uniprot.org/uniprot/P28472

Read More

Answer

Thank you very much for your comprehension, it’s really appreciated.
Unfortunately, because we carry over 80,000 products, it isn't feasible for us to keep small sample sizes of our products, and therefore I am not able to offer a test sample of ab98968.
However, in this case, ab98968 is guaranteed to work in IHC-P in human, rat and mouse.
If you had any problem using this antibody, please contact us. It is covered by our Abpromise® guarantee, which ensures that you can trust our products, and they should work in the tested species and applications stated on the datasheet, or we will offer a replacement, credit, or refund, if reported within 6 months of purchase.
To read about our Abpromise policy: https://www.abcam.com/index.html?pageconfig=abpromise
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up