Overview

  • Product name

    Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7]
    See all GABA B Receptor 2/GABBR2 primary antibodies
  • Description

    Mouse monoclonal [5G7F7] to GABA B Receptor 2/GABBR2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GABA B Receptor 2/GABBR2 aa 319-383 (internal sequence). Expressed in E. Coli.
    Sequence:

    FEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKT LQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFR NGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKT IILEQLRKISLPLYS


    Database link: O75899

  • Positive control

    • GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein; GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cerebellum tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR290583-1 are from Tissue Culture Supernatant

     This product was previously labelled as GABA B Receptor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab181736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 106 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Receptor for GABA. The activity of this receptor is mediated by G-proteins that inhibit adenylyl cyclase activity, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipids hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA-B-R inhibit neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA-B-R decrease neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception.
  • Tissue specificity

    Highly expressed in brain, especially in cerebral cortex, thalamus, hippocampus, frontal, occipital and temporal lobe, occipital pole and cerebellum, followed by corpus callosum, caudate nucleus, spinal cord, amygdala and medulla. Weakly expressed in heart, testis and skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.
  • Domain

    Alpha-helical parts of the C-terminal intracellular region mediate heterodimeric interaction with GABA-B receptor 1.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Moreover coexpression of GABA-B-R1 and GABA-B-R2 appears to be a prerequisite for maturation and transport of GABA-B-R1 to the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BcDNA:GH07312 antibody
    • CG6706 antibody
    • CT20836 antibody
    • D Gaba2 antibody
    • FLJ36928 antibody
    • G protein coupled receptor 51 antibody
    • G-protein coupled receptor 51 antibody
    • GAB B R2 antibody
    • GABA B R2 antibody
    • GABA B receptor 2 antibody
    • GABA-B receptor 2 antibody
    • GABA-B-R2 antibody
    • GABA-BR2 antibody
    • GABAB R2 antibody
    • GABABR 2 antibody
    • GABABR2 antibody
    • GABB R2 antibody
    • GABBR 2 antibody
    • Gabbr2 antibody
    • GABR2_HUMAN antibody
    • Gamma aminobutyric acid B receptor 2 antibody
    • Gamma aminobutyric acid GABA B receptor 2 antibody
    • Gamma aminobutyric acid type B receptor subunit 2 antibody
    • Gamma-aminobutyric acid type B receptor subunit 2 antibody
    • Gb 2 antibody
    • Gb2 antibody
    • GH07312 antibody
    • GPR 51 antibody
    • GPR51 antibody
    • GPRC 3B antibody
    • GPRC3B antibody
    • HG 20 antibody
    • HG20 antibody
    • HRIHFB2099 antibody
    • Metabotropic GABA B receptor subtype 2 antibody
    • OTTHUMP00000021776 antibody
    • OTTHUMP00000063797 antibody
    • R2 SUBUNIT antibody
    see all

Images

  • All lanes : Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : GABA B Receptor 2/GABBR2 (aa 319-483)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 106 kDa

  • Immunofluorescent analysis of HeLa cells labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye.

  • Anti-GABA B Receptor 2/GABBR2 antibody [5G7F7] (ab181736) at 1/500 dilution + GABA B Receptor 2/GABBR2 (aa 319-483) recombinant protein

    Predicted band size: 106 kDa

  • Immunohistochemical analysis of paraffin embedded Human cerebellum tissue labeling GABA B Receptor 2/GABBR2 with ab181736 at 1/200.

References

ab181736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up