Overview

  • Product name

    Anti-GABA Transporter 2 antibody
  • Description

    Rabbit polyclonal to GABA Transporter 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human GABA Transporter 2 aa 1-40.
    Sequence:

    MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKME


    Database link: Q9NSD5

  • Positive control

    • WB: Mouse heart, brain and kidney lysates. IHC-P: Human testis and kidney tissues. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 69 kDa (predicted molecular weight: 68 kDa).
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Sodium-dependent GABA and taurine transporter. In presynaptic terminals, regulates GABA signaling termination through GABA uptake. May also be involved in beta-alanine transport.
  • Tissue specificity

    Expressed in brain, kidney, lung, liver and testis.
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A13 subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GABA transport protein antibody
    • GAT 2 antibody
    • GAT-2 antibody
    • GAT2 antibody
    • S6A13_HUMAN antibody
    • SLC6A13 antibody
    • Sodium- and chloride-dependent GABA transporter 2 antibody
    • Solute carrier family 6 (Neurotransmitter transporter, GABA), member 13 antibody
    • Solute carrier family 6 member 13 antibody
    see all

Images

  • All lanes : Anti-GABA Transporter 2 antibody (ab229815) at 1/500 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Mouse kidney lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 68 kDa
    Observed band size: 69 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human testis tissue stained for GABA Transporter 2 using ab229815 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GABA Transporter 2 using ab229815 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for GABA Transporter 2 (green) using ab229815 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab229815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up