Overview

  • Product name

    Anti-GABPA antibody
  • Description

    Rabbit polyclonal to GABPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human GABPA aa 7-150.
    Sequence:

    EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLE PRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEP KLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK


    Database link: Q06546

  • Positive control

    • ICC/IF: U-251 MG cells. WB: RT4 and U-251 MG cell lysate; Human tonsil tissue lysate. IHC-P: Human lymph node tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 51 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • E4TF 1A antibody
    • E4TF1 60 antibody
    • E4TF1A antibody
    • GA binding protein alpha chain antibody
    • GA binding protein transcription factor alpha subunit 60kDa antibody
    • GA binding protein transcription factor alpha subunit antibody
    • GA-binding protein alpha chain antibody
    • GABP A antibody
    • GABP alpha subunit antibody
    • GABP subunit alpha antibody
    • Gabpa antibody
    • GABPA_HUMAN antibody
    • Human nuclear respiratory factor 2 subunit alpha antibody
    • NFT 2 antibody
    • NFT2 antibody
    • NRF 2 antibody
    • NRF 2A antibody
    • NRF2 antibody
    • NRF2A antibody
    • Nuclear respiratory factor 2 alpha subunit antibody
    • Nuclear respiratory factor 2 subunit alpha antibody
    • RCH04A07 antibody
    • Transcription factor E4TF1 60 antibody
    • Transcription factor E4TF1-60 antibody
    see all

Images

  • All lanes : Anti-GABPA antibody (ab224325) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human liver tissue lysate
    Lane 4 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 51 kDa

  • Paraffin-embedded human lymph node tissue stained for GABPA using ab224325 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for GABPA (green) using ab224325 at 4 µg/ml in ICC/IF.

References

ab224325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up