Overview

  • Product name

  • Description

    Rabbit polyclonal to GABPB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GABPB2 aa 163-440.
    Sequence:

    QVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHA STVQFSNSTTSVLATLAALAEASVPLSNSHRATANTEEIIEGNSVDSSIQ QVMGSGGQRVITIVTDGVPLGNIQTSIPTGGIGQPFIVTVQDGQQVLTVP AGKVAEETVIKEEEEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQLQ EANRRAQEYRHQLLKKEQEAEQYRLKLEAIARQQPNGVDFTMVEEVAEVD AVVVTEGELEERETKVTGSAGTTEPHTR


    Database link: Q8TAK5

  • Positive control

    • WB: Jurkat, HEK-293, HeLa and A549 whole cell lysates. ICC/IF: HeLa cells. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May function as transcription factor capable of interacting with purine rich repeats (GA repeats).
  • Sequence similarities

    Contains 5 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BABPB2 antibody
    • E4TF1 antibody
    • E4TF1 47 antibody
    • E4TF1 53 antibody
    • E4TF1B antibody
    • GA binding protein beta chain antibody
    • GA binding protein transcription factor beta subunit 2 antibody
    • GA-binding protein subunit beta-2 antibody
    • GABP 2 antibody
    • GABP subunit beta 1 antibody
    • GABP subunit beta 2 antibody
    • GABP subunit beta-2 antibody
    • GABP2_HUMAN antibody
    • GABPB 1 antibody
    • GABPB-2 antibody
    • GABPB1 antibody
    • Gabpb2 antibody
    • NRF2B1 antibody
    • NRF2B2 antibody
    • Nuclear respiratory factor 2 antibody
    • Nuclear respiratory factor 2 subunit beta antibody
    • RP11-68I18.1 antibody
    • Transcription factor E4TF1 47 antibody
    • Transcription factor E4TF1 53 antibody
    see all

Images

  • All lanes : Anti-GABPB2 antibody (ab234864) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human testis tissue stained for GABPB2 using ab234864 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GABPB2 (green) using ab234864 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up