Overview

  • Product name

    Anti-GABPB2/Nuclear respiratory factor 2 antibody
    See all GABPB2/Nuclear respiratory factor 2 primary antibodies
  • Description

    Rabbit polyclonal to GABPB2/Nuclear respiratory factor 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human GABPB2/Nuclear respiratory factor 2 aa 231-395.
    Sequence:

    AEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGI QLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQ CIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQ KLEAMTRLQTNKEAV


    Database link: Q06547

  • Positive control

    • IHC-P: Human testis and skin tissue.
  • General notes

     This product was previously labelled as GABPB2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
  • Sequence similarities

    Contains 5 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BABPB2 antibody
    • E4TF1 antibody
    • E4TF1-47 antibody
    • E4TF1-53 antibody
    • E4TF1B antibody
    • GA binding protein transcription factor beta subunit 1 transcript variant gamma 2 antibody
    • GA binding protein transcription factor, beta subunit 1 antibody
    • GA binding protein transcription factor, beta subunit 2 antibody
    • GA-binding protein subunit beta-1 antibody
    • GABP subunit beta-1 antibody
    • GABP subunit beta-2 antibody
    • GABP1_HUMAN antibody
    • GABPB antibody
    • GABPB-1 antibody
    • GABPB-2 antibody
    • GABPB1 antibody
    • GABPB2 antibody
    • NRF2B1 antibody
    • NRF2B2 antibody
    • Nuclear respiratory factor 2 antibody
    • Transcription factor E4TF1-47 antibody
    • Transcription factor E4TF1-53 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for GABPB2/Nuclear respiratory factor 2 using ab234852 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for GABPB2/Nuclear respiratory factor 2 using ab234852 at 1/100 dilution in immunohistochemical analysis.

References

ab234852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up