Overview

  • Product name

    Anti-GABRE antibody [S413-67]
    See all GABRE primary antibodies
  • Description

    Mouse monoclonal [S413-67] to GABRE
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Fusion protein corresponding to Human GABRE aa 27-253. Extracellular N-terminus
    Sequence:

    SKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILN TILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTW YDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVR IYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYK WENFKLEINEKNSWKLFQFDFTGVSNK


    Database link: P78334

  • Positive control

    • WB: Rat brain tissue lysate. ICC/IF: SK-N-BE cells.
  • General notes

     This product was previously labelled as GABA Receptor Epsilon

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.1% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    S413-67
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab241998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 58 kDa.
ICC/IF 1/100.

Target

  • Function

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
  • Tissue specificity

    Expressed in many tissues. Highest levels of expression in adult heart and placenta.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRE sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GABA(A) receptor epsilon antibody
    • GABA(A) receptor subunit epsilon antibody
    • Gabre antibody
    • Gamma aminobutyric acid (GABA) A receptor epsilon antibody
    • Gamma aminobutyric acid receptor subunit epsilon antibody
    • Gamma-aminobutyric acid receptor subunit epsilon antibody
    • GBRE_HUMAN antibody
    see all

Images

  • 4% formaldehyde-fixed SK-N-BE (human neuroblastoma cell line) cells stained for GABRE (green, C) using ab241998 at 1/100 dilution for 1 hour at room temperature in ICC/IF. Secondary antibody is Goat Anti-Mouse ATTO 488 at 1/100 dilution. Actin is detected with Phalloidin Texas Red F-Actin stain (red, B). The nuclear counterstain is DAPI (blue, A). (D) is a composite image.

  • Anti-GABRE antibody [S413-67] (ab241998) at 1/1000 dilution + Rat brain tissue lysate at 10 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/200 dilution

    Developed using the ECL technique.

    Predicted band size: 58 kDa


    Exposure time: 6 minutes


    Primary and secondary incubation for 1 hour at room temperature.

    Blocked for 1 hr at RT.

References

ab241998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up