Overview

  • Product name

    Anti-GAD65 + GAD67 antibody
    See all GAD65 + GAD67 primary antibodies
  • Description

    Rabbit polyclonal to GAD65 + GAD67
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human GAD65 + GAD67 aa 370-420 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. (From GAD65).
    Sequence:

    GLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCN Q


    Database link: Q05329

  • Positive control

    • Mouse embryo lysate; Mouse lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 65 kDa.
IHC-P 1/100 - 1/500.

Target

  • Relevance

    This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma aminobutyric acid from L glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin dependent diabetes. This gene may also play a role in the stiff man syndrome.
  • Cellular localization

    Cytoplasm; cytosol. Associated to cytoplasmic vesicles. In neurons, cytosolic leaflet of Golgi membranes and presynaptic clusters.
  • Database links

  • Alternative names

    • 65 kDa glutamic acid decarboxylase antibody
    • 67 kDa glutamic acid decarboxylase antibody
    • GAD 65 antibody
    • GAD 67 antibody
    • GAD1 antibody
    • GAD2 antibody
    • Glutamate decarboxylase 1 antibody
    • Glutamate decarboxylase 2 antibody
    • Glutamate decarboxylase 2 pancreatic islets and brain 65kDa antibody
    • Glutamate decarboxylase 65 kDa isoform antibody
    • Glutamate decarboxylase 67 kDa isoform antibody
    • SCP antibody
    see all

Images

  • Anti-GAD65 + GAD67 antibody (ab217034) at 1/300 dilution + Mouse embryo lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/5000 dilution

    Predicted band size: 65 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse brain tissue labeling GAD65 + GAD67 with ab217034 at 1/100 dilution, followed by secondary antibody detection.

References

ab217034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up