Overview

  • Product name

  • Description

    Rabbit polyclonal to GAD67
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human GAD67 aa 510-560 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMESGTTMVGYQPQ G


    Database link: Q99259-1

  • Positive control

    • Rat brain and mouse hippocampus tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the production of GABA.
  • Tissue specificity

    Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain.
  • Involvement in disease

    Defects in GAD1 are the cause of cerebral palsy spastic quadriplegic type 1 (CPSQ1) [MIM:603513]. A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals manifest symmetrical, non-progressive spasticity and no adverse perinatal history or obvious underlying alternative diagnosis. Developmental delay, mental retardation and sometimes epilepsy can be part of the clinical picture.
  • Sequence similarities

    Belongs to the group II decarboxylase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 67 kDa glutamic acid decarboxylase antibody
    • CPSQ1 antibody
    • DCE1 antibody
    • DCE1_HUMAN antibody
    • EC 4.1.1.15 antibody
    • FLJ45882 antibody
    • GAD 1 antibody
    • GAD 67 antibody
    • GAD antibody
    • GAD-67 antibody
    • GAD1 antibody
    • Glutamate decarboxylase 1 (brain, 67kDa) antibody
    • Glutamate decarboxylase 1 antibody
    • Glutamate decarboxylase 1 brain 67kD antibody
    • Glutamate decarboxylase 1 brain 67kDa antibody
    • Glutamate decarboxylase 67 kDa isoform antibody
    • Glutamate decarboxylase, brain, 67-KD antibody
    • OTTHUMP00000041054 antibody
    • OTTHUMP00000041055 antibody
    • OTTHUMP00000228572 antibody
    • SCP antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling GAD67 using ab203081 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse hippocampus tissue, labeling GAD67 using ab203081 at a 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up