Overview

  • Product name

    Anti-GADD34 antibody [OTI2B11]
    See all GADD34 primary antibodies
  • Description

    Mouse monoclonal [OTI2B11] to GADD34
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GADD34 aa 1-674. Produced in HEK-293T cells (NP_055145).
    Sequence:

    MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAV KGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKT SSSLPEAWGLLDDDDGMYGEREATSVPRGQGSQFADGQRAPLSPSLLIRT LQGSDKNPGEEKAEEEGVAEEEGVNKFSYPPSHRECCPAVEEEDDEEAVK KEAHRTSTSALSPGSKPSTWVSCPGEEENQATEDKRTERSKGARKTSVSP RSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLK SWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDT EEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEE EDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDS EDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWG EAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETP LKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQ EELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLS QAVATPSRSSAAAAAALDLSGRRG


    Database link: O75807

  • Positive control

    • WB: pCMV6-ENTRY GADD34 cDNA transfected HEK-293T cell lysate; HepG2, HeLa, SVT2, A549 and MCF7 cell lysates. ICC/IF: COS7 cells transiently transfected by pCMV6-ENTRY GADD34. Flow Cyt: HEK-293T cells transfected with GADD34; HeLa and Jurkat cells.
  • General notes

    Clone OTI2B11 (formerly 2B11).

Properties

Applications

Our Abpromise guarantee covers the use of ab236516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 73 kDa.
ICC/IF 1/100.
Flow Cyt 1/100.

Target

  • Function

    Recruits the serine/threonine-protein phosphatase PP1 to dephosphorylate the translation initiation factor eIF-2A/EIF2S1, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. Down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 by PP1. May promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'.
  • Sequence similarities

    Belongs to the PPP1R15 family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine by LYN; which impairs its antiproliferative activity.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptosis associated protein antibody
    • GADD 34 antibody
    • Growth arrest and DNA damage inducible 34 antibody
    • Growth arrest and DNA damage-inducible protein GADD34 antibody
    • Myeloid differentiation primary response protein MyD116 homolog antibody
    • Ppp1r15a antibody
    • PR15A_HUMAN antibody
    • Protein phosphatase 1 regulatory (inhibitor) subunit 15A antibody
    • Protein phosphatase 1 regulatory subunit 15A antibody
    see all

Images

  • All lanes : Anti-GADD34 antibody [OTI2B11] (ab236516) at 1/500 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY GADD34 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 73 kDa

  • All lanes : Anti-GADD34 antibody [OTI2B11] (ab236516) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : SVT2 cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) cell lysate
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 7 : MDCK (canine kidney cell line) cell lysate
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 73 kDa

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GADD34 stained for GADD34 (green) using ab236516 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell line transfected with either GADD34 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling GADD34 with ab236516 at 1/100 dilution.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling GADD34 with ab236516 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling GADD34 with ab236516 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

References

ab236516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up