Overview

  • Product name

  • Description

    Rabbit polyclonal to GADD45A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
    Unsuitable for: ICC
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human GADD45A aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    ELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRE S


    Database link: P24522

  • Positive control

    • Rat heart and brain tissues; Rat brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200. Predicted molecular weight: 18 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

  • Application notes
    Is unsuitable for ICC.
  • Target

    Images

    • All lanes : Anti-GADD45A antibody (ab203090) at 1/200 dilution

      Lane 1 : Rat brain lysate
      Lane 2 : Rat kidney lysate

      Secondary
      All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution

      Predicted band size: 18 kDa

    • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling GADD45A with ab203090 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat heart tissue labeling GADD45A with ab203090 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    References

    ab203090 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab203090.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up