Overview

  • Product name

  • Description

    Rabbit polyclonal to GADD45B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Fusion protein corresponding to Human GADD45B aa 1-160. (BC113466. The identity of the protein fusion partner is GST).
    Sequence:

    MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVD PDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQ LLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQ WVPYISLQER


    Database link: O75293

  • Positive control

    • Human colon cancer and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab197990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

Target

  • Function

    Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
  • Sequence similarities

    Belongs to the GADD45 family.
  • Information by UniProt
  • Database links

  • Form

    It localizes to the nucleus.
  • Alternative names

    • GA45B_HUMAN antibody
    • GADD45 Beta antibody
    • Gadd45b antibody
    • GADD45BETA antibody
    • Growth arrest and DNA damage inducible 45 beta antibody
    • Growth arrest and DNA damage inducible beta antibody
    • Growth arrest and DNA damage-inducible gene GADD45, beta antibody
    • Growth arrest and DNA damage-inducible protein GADD45 beta antibody
    • Growth arrest and DNA-damage-inducible protein GADD45 beta antibody
    • MY118 antibody
    • MYD118 antibody
    • MYD118, mouse, homolog of antibody
    • Myeloid differentiation primary response gene antibody
    • Myeloid differentiation primary response protein MyD118 antibody
    • Negative growth regulatory protein MyD118 antibody
    • Negative growth-regulatory protein MyD118 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon cancer tissue labeling GADD45B with ab197990 at 1/30 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human brain tissue labeling GADD45B with ab197990 at 1/30 dilution.

References

ab197990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (Liver)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
30 µg
Specification
Liver
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Pei Pei Lu

Verified customer

Submitted Apr 29 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up