Overview

  • Product name

  • Description

    Rabbit polyclonal to GADD45G/CR6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Fusion protein corresponding to Human GADD45G/CR6 aa 1-159. Full length form. The identity of the protein fusion partner is GST
    Sequence:

    MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVL NVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQR LAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVND WVPSITLPE


    Database link: O95257

  • Positive control

    • Human tonsil tissue.
  • General notes

     This product was previously labelled as GADD45G

     

Properties

Applications

Our Abpromise guarantee covers the use of ab197400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/200.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling GADD45G/CR6 with ab197400 at 1/120.

References

ab197400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up