Overview

  • Product name

    Anti-GAL3ST1/Cerebroside sulfotransferase antibody
    See all GAL3ST1/Cerebroside sulfotransferase primary antibodies
  • Description

    Rabbit polyclonal to GAL3ST1/Cerebroside sulfotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GAL3ST1/Cerebroside sulfotransferase aa 57-196. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    LEPEAVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKF AFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTN AIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGKLTEF


    Database link: Q99999

  • Positive control

    • WB: Recombinant Human GAL3ST1 /Cerebroside sulfotransferase protein (ab160525), Mouse testis tissue lysate; Recombinant human GAL3ST1/Cerebroside sulfotransferase protein. IHC-P: Human kidney and breast cancer tissues.
  • General notes

     This product was previously labelled as GAL3ST1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes (By similarity). Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro).
  • Tissue specificity

    Expressed in kidney proximal tubule, gastric mucosa and adenocarcinoma. Highly expressed in renal cell carcinoma cell lines.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities

    Belongs to the galactose-3-O-sulfotransferase family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3' phosphoadenosine 5' phosphosulfate:GalCer sulfotransferase antibody
    • 3' phosphoadenylylsulfate:galactosylceramide 3' sulfotransferase antibody
    • 3''-phosphoadenosine-5''-phosphosulfate:GalCer sulfotransferase antibody
    • 3''-phosphoadenylylsulfate:galactosylceramide 3''-sulfotransferase antibody
    • Cerebroside (3' phosphoadenylylsulfate:galactosylceramide 3') sulfotransferase antibody
    • Cerebroside sulfotransferase antibody
    • CST antibody
    • G3ST1_HUMAN antibody
    • GAL3ST1 antibody
    • Galactose 3 O sulfotransferase 1 antibody
    • Galactosylceramide sulfotransferase antibody
    • GalCer sulfotransferase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Mouse testis lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Recombinant human GAL3ST1/Cerebroside sulfotransferase protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

References

ab232758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up