Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GAL3ST1/Cerebroside sulfotransferase antibody
See all GAL3ST1/Cerebroside sulfotransferase primary antibodies -
Description
Rabbit polyclonal to GAL3ST1/Cerebroside sulfotransferase -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human GAL3ST1/Cerebroside sulfotransferase aa 57-196. (N-terminal His-tag and GST-tag; Expressed in E.coli).
Sequence:LEPEAVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKF AFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTN AIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGKLTEF
Database link: Q99999 -
Positive control
- WB: Recombinant Human GAL3ST1 /Cerebroside sulfotransferase protein (ab160525), Mouse testis tissue lysate; Recombinant human GAL3ST1/Cerebroside sulfotransferase protein. IHC-P: Human kidney and breast cancer tissues.
-
General notes
This product was previously labelled as GAL3ST1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232758 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 - 5 µg/ml. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes (By similarity). Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro). -
Tissue specificity
Expressed in kidney proximal tubule, gastric mucosa and adenocarcinoma. Highly expressed in renal cell carcinoma cell lines. -
Pathway
Lipid metabolism; sphingolipid metabolism. -
Sequence similarities
Belongs to the galactose-3-O-sulfotransferase family. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9514 Human
- Entrez Gene: 53897 Mouse
- Omim: 602300 Human
- SwissProt: Q99999 Human
- SwissProt: Q9JHE4 Mouse
- Unigene: 17958 Human
- Unigene: 103414 Mouse
-
Alternative names
- 3' phosphoadenosine 5' phosphosulfate:GalCer sulfotransferase antibody
- 3' phosphoadenylylsulfate:galactosylceramide 3' sulfotransferase antibody
- 3''-phosphoadenosine-5''-phosphosulfate:GalCer sulfotransferase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
Formalin-fixed, paraffin-embedded human kidney tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Mouse testis lysate
Secondary
HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution -
Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Recombinant human GAL3ST1/Cerebroside sulfotransferase protein
Secondary
HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
Datasheets and documents
References
ab232758 has not yet been referenced specifically in any publications.