Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to GAL3ST1/Cerebroside sulfotransferase
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-GAL3ST1/Cerebroside sulfotransferase antibody
    See all GAL3ST1/Cerebroside sulfotransferase primary antibodies

  • Description

    Rabbit polyclonal to GAL3ST1/Cerebroside sulfotransferase

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, IHC-Pmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Recombinant fragment corresponding to Human GAL3ST1/Cerebroside sulfotransferase aa 57-196. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    LEPEAVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKF AFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTN AIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGKLTEF


    Database link: Q99999

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Recombinant Human GAL3ST1 /Cerebroside sulfotransferase protein (ab160525), Mouse testis tissue lysate; Recombinant human GAL3ST1/Cerebroside sulfotransferase protein. IHC-P: Human kidney and breast cancer tissues.

  • General notes

     This product was previously labelled as GAL3ST1

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes (By similarity). Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro).

  • Tissue specificity

    Expressed in kidney proximal tubule, gastric mucosa and adenocarcinoma. Highly expressed in renal cell carcinoma cell lines.

  • Pathway

    Lipid metabolism; sphingolipid metabolism.

  • Sequence similarities

    Belongs to the galactose-3-O-sulfotransferase family.

  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • 3' phosphoadenosine 5' phosphosulfate:GalCer sulfotransferase antibody
      • 3' phosphoadenylylsulfate:galactosylceramide 3' sulfotransferase antibody
      • 3''-phosphoadenosine-5''-phosphosulfate:GalCer sulfotransferase antibody
      • 3''-phosphoadenylylsulfate:galactosylceramide 3''-sulfotransferase antibody
      • Cerebroside (3' phosphoadenylylsulfate:galactosylceramide 3') sulfotransferase antibody
      • Cerebroside sulfotransferase antibody
      • CST antibody
      • G3ST1_HUMAN antibody
      • GAL3ST1 antibody
      • Galactose 3 O sulfotransferase 1 antibody
      • Galactosylceramide sulfotransferase antibody
      • GalCer sulfotransferase antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)

      Formalin-fixed, paraffin-embedded human kidney tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)

      Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GAL3ST1/Cerebroside sulfotransferase using ab232758 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Western blot - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Western blot - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Mouse testis lysate

      Secondary
      HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
    • Western blot - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Western blot - Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758)
      Anti-GAL3ST1/Cerebroside sulfotransferase antibody (ab232758) at 3 µg/ml + Recombinant human GAL3ST1/Cerebroside sulfotransferase protein

      Secondary
      HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab232758? Please let us know so that we can cite the reference in this datasheet.

    ab232758 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab232758.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com