Overview

  • Product name

  • Description

    Rabbit polyclonal to GAL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human GAL4 aa 1-323. (Expressed in E.coli).
    Sequence:

    MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNF VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAA FELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI GGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQG GLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNS LLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR LSAFQRVDTLEIQGDVTLSYVQI


    Database link: P56470

  • Positive control

    • IHC-P: Human stomach tissue. WB: Mouse cerebellum lysate; Recombinant human GAL4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 36 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
  • Sequence similarities

    Contains 2 galectin domains.
  • Domain

    Contains two homologous but distinct carbohydrate-binding domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen NY CO 27 antibody
    • Antigen NY-CO-27 antibody
    • Antigen NYCO27 antibody
    • GAL 4 antibody
    • Gal-4 antibody
    • GAL4 antibody
    • Galectin 4 antibody
    • Galectin-4 antibody
    • Galectin4 antibody
    • Homo sapiens galectin4 mRNA complete cds antibody
    • L 36 lactose binding protein antibody
    • L-36 lactose-binding protein antibody
    • L36 lactose binding protein antibody
    • L36LBP antibody
    • Lactose binding lectin 4 antibody
    • Lactose-binding lectin 4 antibody
    • Lectin galactoside binding soluble 4 antibody
    • LEG4_HUMAN antibody
    • LGALS4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GAL4 using ab232714 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GAL4 antibody (ab232714) at 2 µg/ml + Recombinant human GAL4 protein

    Predicted band size: 36 kDa

  • Anti-GAL4 antibody (ab232714) at 2 µg/ml + Mouse cerebellum lysate

    Predicted band size: 36 kDa

References

ab232714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up