Overview

  • Product name

  • Description

    Mouse polyclonal to Galanin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human Galanin aa 30-65 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    EKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRE


    Database link: P22466

  • Positive control

    • Rat spinal cord tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion.
  • Sequence similarities

    Belongs to the galanin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GAL 1 antibody
    • GAL antibody
    • GAL GMAP antibody
    • GAL1 antibody
    • GALA_HUMAN antibody
    • Galanin message associated peptide antibody
    • Galanin message-associated peptide antibody
    • Galanin precursor antibody
    • Galanin prepropeptide antibody
    • Galanin related peptide antibody
    • Galanin/GMAP prepropeptide antibody
    • GALN antibody
    • GLNN antibody
    • GMAP antibody
    • MGC40167 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat spinal cord tissue labeling Galanin with ab216399 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab216399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up