Overview

  • Product name

  • Description

    Rabbit polyclonal to GALC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human GALC aa 375-535. Expressed in E.coli. N-terminal tag.
    Sequence:

    DGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQ VWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRK GSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPG EHHFTLRQVLN


    Database link: P54803

  • Positive control

    • WB: Recombinant human GALC protein; Human serum; Human lung lysate. IHC-P: Human prostate cancer, liver cancer and liver tissue.
  • General notes

    Protein previously labeled as Galactosylceramidase.

Properties

Applications

Our Abpromise guarantee covers the use of ab232972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 77 kDa.

Target

  • Function

    Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon.
  • Tissue specificity

    Detected in urine. Detected in testis, brain and placenta (at protein level). Detected in kidney and liver.
  • Involvement in disease

    Leukodystrophy, globoid cell
  • Sequence similarities

    Belongs to the glycosyl hydrolase 59 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gacy antibody
    • Galactocerebrosidase antibody
    • Galactocerebroside beta galactosidase antibody
    • Galactocerebroside beta-galactosidase antibody
    • Galactosylceramidase antibody
    • Galactosylceramide beta galactosidase antibody
    • Galactosylceramide beta-galactosidase antibody
    • galactosylceraminidase antibody
    • GALC antibody
    • GALC_HUMAN antibody
    • GALCERase antibody
    • Twitcher antibody
    see all

Images

  • All lanes : Anti-GALC antibody (ab232972) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human lung tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 77 kDa

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for GALC using ab232972 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for GALC using ab232972 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GALC using ab232972 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-GALC antibody (ab232972) at 2 µg/ml + Recombinant human GALC protein

    Predicted band size: 77 kDa

References

ab232972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up