Overview

  • Product name

    Anti-GALE antibody [OTI1C4]
    See all GALE primary antibodies
  • Description

    Mouse monoclonal [OTI1C4] to GALE
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human GALE aa 1-348. Produced in HEK-293T cells (NP_000394).
    Sequence:

    MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLR RVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQK PLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPT GGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGED PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG HIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA


    Database link: Q14376

  • Positive control

    • WB: HEK-293T cell lysate transfected with the pCMV6-ENTRY GALE cDNA; HepG2, HeLa, HT-29, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts; Human testis, omentum, uterus, breast, brain, liver, ovary, thyroid gland, colon and spleen extracts. IHC-P: Human breast adenocarcinoma, colon adenocarcinoma, kidney, liver, ovary adenocarcinoma, prostate, prostate carcinoma, bladder carcinoma and lymph node tissues.
  • General notes

    The clone number has been updated from 1C4 to OTI1C4, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab118033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Function

    Catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine.
  • Pathway

    Carbohydrate metabolism; galactose metabolism.
  • Involvement in disease

    Defects in GALE are the cause of epimerase-deficiency galactosemia (EDG) [MIM:230350]; also known as galactosemia type 3. Clinical features include early-onset cataracts, liver damage, deafness and mental retardation. There are two clinically distinct forms of EDG. (1) A benign, or 'peripheral' form with no detectable GALE activity in red blood cells and characterized by mild symptoms. Some patients may suffer no symptoms beyond raised levels of galactose-1-phosphate in the blood. (2) A much rarer 'generalized' form with undetectable levels of GALE activity in all tissues and resulting in severe features such as restricted growth and mental development.
  • Sequence similarities

    Belongs to the sugar epimerase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ95174 antibody
    • FLJ97302 antibody
    • Galactose 4 epimerase UDP antibody
    • Galactowaldenase antibody
    • galE antibody
    • GALE_HUMAN antibody
    • OTTHUMP00000002991 antibody
    • OTTHUMP00000002994 antibody
    • OTTHUMP00000037931 antibody
    • OTTHUMP00000044857 antibody
    • SDR1E1 antibody
    • short chain dehydrogenase/reductase family 1E member 1 antibody
    • UDP galactose 4 epimerase antibody
    • UDP galactose 4' epimerase antibody
    • UDP glucose 4 epimerase antibody
    • UDP-galactose 4-epimerase antibody
    • UDP-glucose 4-epimerase antibody
    see all

Images

  • All lanes : Anti-GALE antibody [OTI1C4] (ab118033) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY GALE cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 38 kDa

  • Paraffin-embedded human bladder carcinoma tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-GALE antibody [OTI1C4] (ab118033) at 1/500 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human omentum extract
    Lane 3 : Human uterus extract
    Lane 4 : Human breast extract
    Lane 5 : Human brain extract
    Lane 6 : Human liver extract
    Lane 7 : Human ovary extract
    Lane 8 : Human thyroid gland extract
    Lane 9 : Human colon extract
    Lane 10 : Human spleen extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 38 kDa

  • Paraffin-embedded human prostate carcinoma tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast adenocarcinoma tissue stained for GALE using ab118033 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-GALE antibody [OTI1C4] (ab118033) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : HT-29 (Human colorectal adenocarcinoma cell line) cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 38 kDa

References

ab118033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up