Overview

  • Product name

  • Description

    Rabbit polyclonal to Galectin 10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Galectin 10 aa 2-142. Expressed in E.coli.
    Sequence:

    SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIV FHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQ VMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR


    Database link: Q05315

  • Positive control

    • WB: Recombinant human Galectin 10 protein; human leukocyte lysate. IHC-P: Human stomach, kidney, stomach cancer, prostate, cerebrum and pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function

    May have both lysophospholipase and carbohydrate-binding activities.
  • Tissue specificity

    Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
  • Sequence similarities

    Contains 1 galectin domain.
  • Cellular localization

    Cytoplasmic granule. Localized in granules from where it may be secreted or transported to other locations in the cell.
  • Information by UniProt
  • Database links

  • Alternative names

    • BSF3 antibody
    • Charcot Leyden crystal protein antibody
    • Charcot-Leyden crystal protein antibody
    • CLC antibody
    • EC 3.1.1.5 antibody
    • Eosinophil lysophospholipase antibody
    • Gal-10 antibody
    • Galectin-10 antibody
    • LGALS10 antibody
    • LGALS10A antibody
    • LPPL HUMAN antibody
    • LPPL_HUMAN antibody
    • Lysolecithin acylhydrolase antibody
    • MGC149659 antibody
    see all

Images

  • Anti-Galectin 10 antibody (ab231964) at 2 µg/ml + Recombinant human Galectin 10 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 16 kDa

  • Anti-Galectin 10 antibody (ab231964) at 2 µg/ml + Human leukocyte cell lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 16 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Galectin 10 using ab231964 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up