Overview

  • Product name

  • Description

    Rabbit polyclonal to Galectin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Galectin 2 aa 1-132. Expressed in E.coli.
    Sequence:

    MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRF SESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDG HELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE


    Database link: P05162

  • Positive control

    • IHC-P: Human breast cancer, thyroid cancer and thyroid tissue. WB: Recombinant human Galectin 2 protein; Mouse pancreas, intestine and stomach lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    This protein binds beta-galactoside. Its physiological function is not yet known.
  • Sequence similarities

    Contains 1 galectin domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta galactoside binding lectin L14 II antibody
    • Beta-galactoside-binding lectin L-14-II antibody
    • CBP35 antibody
    • Gal-2 antibody
    • GAL3 antibody
    • GALBP antibody
    • Galectin 2 antibody
    • Galectin-2 antibody
    • GALIG antibody
    • HL14 antibody
    • Lactose binding lectin 2 antibody
    • Lactose-binding lectin 2 antibody
    • LEG2_HUMAN antibody
    • LGALS2 antibody
    • MAC2 antibody
    • S Lac lectin 2 antibody
    • S-Lac lectin 2 antibody
    see all

Images

  • All lanes : Anti-Galectin 2 antibody (ab232703) at 2 µg/ml

    Lane 1 : Mouse pancreas tissue lysate.
    Lane 2 : Mouse intestine tissue lysate.
    Lane 3 : Mouse stomach tissue lysate.
  • Anti-Galectin 2 antibody (ab232703) at 2 µg/ml + Recombinant human Galectin 2 protein.
  • Formalin-fixed, paraffin-embedded human thyroid tissue stained for Galectin 2 using ab232703 at 20 µg/mL in immunohistochemical analysis. DAB staining.

    HRP-linked Caprine anti-rabbit IgG Polyclonal antibody (2 μg/mL) was used as a secondary antibody.

     

     

  • Formalin-fixed, paraffin-embedded human thyroid cancer tissue stained for Galectin 2 using ab232703 at 20 µg/mL in immunohistochemical analysis. DAB staining.

    HRP-linked Caprine anti-rabbit IgG Polyclonal antibody (2 μg/mL) was used as a secondary antibody.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Galectin 2 using ab232703 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up