Overview

  • Product name

    Anti-Galectin 2 antibody [C6]
    See all Galectin 2 primary antibodies
  • Description

    Mouse monoclonal [C6] to Galectin 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Galectin 2 aa 1-132. Expressed in E.coli.
    Sequence:

    MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRF SESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDG HELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE


    Database link: P05162

  • Positive control

    • WB: Recombinant human Galectin 2 protein; Pig, mouse and rat stomach lysates. IHC-P: Human kidney and esophagus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C6
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 15 kDa.

Target

Images

  • Anti-Galectin 2 antibody [C6] (ab239501) at 5 µg/ml + Recombinant human Galectin 2 protein

    Predicted band size: 15 kDa

  • Anti-Galectin 2 antibody [C6] (ab239501) at 3 µg + Rat stomach lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml

    Predicted band size: 15 kDa

  • Anti-Galectin 2 antibody [C6] (ab239501) at 3 µg/ml + Pig stomach lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml

    Predicted band size: 15 kDa

  • Anti-Galectin 2 antibody [C6] (ab239501) at 3 µg/ml + Mouse stomach lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml

    Predicted band size: 15 kDa

  • Paraffin-embedded human kidney tissue stained for Galectin 2 using ab239501 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human esophagus tissue stained for Galectin 2 using ab239501 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up