Anti-Galectin 7 antibody (ab227553)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Galectin 7 antibody
See all Galectin 7 primary antibodies -
Description
Rabbit polyclonal to Galectin 7 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Galectin 7 aa 1-136.
Sequence:MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALH FNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKA VVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Database link: P47929 -
Positive control
- WB: Recombinant Galectin 7 protein; HEK-293T transfected with Galectin 7, whole cell lysate. IP: HEK-293T transfected with Galectin 7, whole cell extract.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab227553 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/3000. Predicted molecular weight: 15 kDa. | |
| IP | 1/100 - 1/500. |
Target
-
Function
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. -
Tissue specificity
Mainly expressed in stratified squamous epithelium. -
Sequence similarities
Contains 1 galectin domain. -
Cellular localization
Cytoplasm. Nucleus. Secreted. May be secreted by a non-classical secretory pathway. - Information by UniProt
-
Database links
- Entrez Gene: 3963 Human
- Entrez Gene: 653499 Human
- Omim: 600615 Human
- SwissProt: P47929 Human
- Unigene: 558355 Human
- Unigene: 707031 Human
-
Alternative names
- Gal-7 antibody
- GAL7 antibody
- Galectin 7B antibody
see all
Images
-
Western blot - Anti-Galectin 7 antibody (ab227553)Anti-Galectin 7 antibody (ab227553) at 1/90000 dilution + Recombinant Galectin 7 protein at 0.1 µg
Predicted band size: 15 kDa -
Western blot - Anti-Galectin 7 antibody (ab227553)All lanes : Anti-Galectin 7 antibody (ab227553) at 1/1000 dilution
Lane 1 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with Galectin 7, whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 15 kDa15% SDS-PAGE gel.
-
Immunoprecipitation - Anti-Galectin 7 antibody (ab227553)Galectin 7 was immunoprecipitated from Galectin 7-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract with 4 μg ab227553. Western blot was performed from the immunoprecipitate using ab227553 at 1/500 dilution.
Lane 1: 4 µg preimmune Rabbit IgG instead of ab227553 in Galectin 7-transfected HEK-293T whole cell lysate.
Lane 2: ab227553 IP in Galectin 7-transfected HEK-293T whole cell lysate.
15% SDS-PAGE
References
ab227553 has not yet been referenced specifically in any publications.
