Anti-Galectin 7 antibody (ab227553)
Key features and details
- Rabbit polyclonal to Galectin 7
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Galectin 7 antibody
See all Galectin 7 primary antibodies -
Description
Rabbit polyclonal to Galectin 7 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Galectin 7 aa 1-136.
Sequence:MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALH FNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKA VVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Database link: P47929 -
Positive control
- WB: Recombinant Galectin 7 protein; HEK-293T transfected with Galectin 7, whole cell lysate. IP: HEK-293T transfected with Galectin 7, whole cell extract.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab227553 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/3000. Predicted molecular weight: 15 kDa. | |
IP | 1/100 - 1/500. |
Target
-
Function
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. -
Tissue specificity
Mainly expressed in stratified squamous epithelium. -
Sequence similarities
Contains 1 galectin domain. -
Cellular localization
Cytoplasm. Nucleus. Secreted. May be secreted by a non-classical secretory pathway. - Information by UniProt
-
Database links
- Entrez Gene: 3963 Human
- Entrez Gene: 653499 Human
- Omim: 600615 Human
- SwissProt: P47929 Human
- Unigene: 558355 Human
- Unigene: 707031 Human
-
Alternative names
- Gal-7 antibody
- GAL7 antibody
- Galectin 7B antibody
see all
Images
-
Anti-Galectin 7 antibody (ab227553) at 1/90000 dilution + Recombinant Galectin 7 protein at 0.1 µg
Predicted band size: 15 kDa -
All lanes : Anti-Galectin 7 antibody (ab227553) at 1/1000 dilution
Lane 1 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with Galectin 7, whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 15 kDa15% SDS-PAGE gel.
-
Galectin 7 was immunoprecipitated from Galectin 7-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract with 4 μg ab227553. Western blot was performed from the immunoprecipitate using ab227553 at 1/500 dilution.
Lane 1: 4 µg preimmune Rabbit IgG instead of ab227553 in Galectin 7-transfected HEK-293T whole cell lysate.
Lane 2: ab227553 IP in Galectin 7-transfected HEK-293T whole cell lysate.
15% SDS-PAGE
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab227553 has not yet been referenced specifically in any publications.