Anti-galectin 9/Gal-9 antibody (ab216479)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-galectin 9/Gal-9 antibody
See all galectin 9/Gal-9 primary antibodies -
Description
Rabbit polyclonal to galectin 9/Gal-9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat
-
Immunogen
Synthetic peptide corresponding to Rat galectin 9/Gal-9 aa 95-145 conjugated to keyhole limpet haemocyanin.
Sequence:GMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHLSFI N
Database link: P97840 -
Positive control
- Mouse kidney tissue.
-
General notes
Previously labelled as galectin 9.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab216479 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil chemoattractant. -
Tissue specificity
Peripheral blood leukocytes and lymphatic tissues. Overexpressed in Hodgkin disease tissue. -
Sequence similarities
Contains 2 galectin domains. -
Domain
Contains two homologous but distinct carbohydrate-binding domains. -
Cellular localization
Cytoplasm. Secreted. May also be secreted by a non-classical secretory pathway. - Information by UniProt
-
Database links
- Entrez Gene: 16859 Mouse
- Entrez Gene: 25476 Rat
- SwissProt: O08573 Mouse
- SwissProt: P97840 Rat
- Unigene: 341434 Mouse
- Unigene: 10706 Rat
-
Alternative names
- 36 kDa beta-galactoside-binding lectin antibody
- Ecalectin antibody
- Gal-9 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-galectin 9/Gal-9 antibody (ab216479)Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling galectin 9/Gal-9 using ab216479 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab216479 has not yet been referenced specifically in any publications.
