Overview

  • Product name

  • Description

    Rabbit polyclonal to GALM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human GALM aa 227-321.
    Sequence:

    PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQP GVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP


    Database link: Q96C23

  • Positive control

    • A431 cells; Human fallopian tube tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent analysis of formalin-fixed, Triton X-100 permealized A431 cells labeling GALM using ab204324 at 4 μg/ml (green).

  • Immunohistochemical analysis of Human fallopian tube tissue labeling GALM with ab204324 at 1/50 dilution.

References

ab204324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up