Overview

  • Product name

    Anti-GALNS/Chondroitinase antibody
    See all GALNS/Chondroitinase primary antibodies
  • Description

    Rabbit polyclonal to GALNS/Chondroitinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat GALNS/Chondroitinase aa 172-381. (Expressed in E.coli).
    Sequence:

    DNKVKPNIPVYRDWEMVGRFYEEFPINLKTGEANLTQLYLQEALDFIRTQ HARQSPFFLYWAIDATHAPVYASKQFLGTSLRGRYGDAVREIDDSVGKIL SLLQNLGISKNTFVFFTSDNGAALISAPKEGGSNGPFLCGKQTTFEGGMR EPAIAWWPGHIAAGQVSHQLGSIMDLFTTSLSLAGLKPPSDRVIDGLDLL PTMLQGHIID


    Database link: Q32KJ6

  • Positive control

    • WB: Recombinant rat GALNS/Chondroitinase protein; Mouse and pig liver lysates. IHC-P: Rat kidney tissue.
  • General notes

     This product was previously labelled as GALNS

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Relevance

    GALNS (N-acetylgalactosamine-6-sulfatase) is a lysosomal exohydrolase which catalyzes the hydrolysis of the 6-sulfate groups of the N-acetyl-D-galactosamine 6-sulfate units of chondroitin sulfate and of the D-galactose 6-sulfate units of keratan sulfate. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder.
  • Cellular localization

    Lysosome
  • Database links

  • Alternative names

    • Chondroitinase antibody
    • Chondroitinsulfatase antibody
    • FLJ00319 antibody
    • FLJ17434 antibody
    • FLJ42844 antibody
    • FLJ98217 antibody
    • Galactosamine (N acetyl) 6 sulfate sulfatase antibody
    • Galactose 6 sulfate sulfatase antibody
    • GALNAC6S antibody
    • GalNAc6S sulfatase antibody
    • GALNS6 antibody
    • GAS antibody
    • mFLJ00319 antibody
    • MPS4A antibody
    • N acetylgalactosamine 6 sulfatase antibody
    • N acetylgalactosamine 6 sulfate sulfatase antibody
    see all

Images

  • Anti-GALNS/Chondroitinase antibody (ab231647) at 3 µg/ml + Recombinant rat GALNS/Chondroitinase protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 58 kDa

  • All lanes : Anti-GALNS/Chondroitinase antibody (ab231647) at 3 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 58 kDa

  • Paraffin-embedded rat kidney tissue stained for GALNS/Chondroitinase using ab231647 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for GALNS/Chondroitinase using ab231647 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up