Overview

  • Product name

    Anti-GALNT11 antibody
  • Description

    Rabbit polyclonal to GALNT11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GALNT11 aa 420-606.
    Sequence:

    DLKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIF VNRGPKRPKVLQRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQ IWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGKNNR LYQVSVGQCLRAVDPLGQKGSVAMAICDGSSSQQWHL


    Database link: Q8NCW6

  • Positive control

    • IHC-P: Human gastric cancer and cervical cancer tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin.
  • Tissue specificity

    Highly expressed in kidney. Expressed at intermediate level in brain, heart and skeletal muscle. Weakly expressed other tissues. In kidney, it is strongly expressed in tubules but not expressed in glomeruli.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A430075I06Rik antibody
    • AI648252 antibody
    • E430002F06Rik antibody
    • FLJ21634 antibody
    • GalNAc Transferase 11 antibody
    • GalNAc-T11 antibody
    • GalNAcT11 antibody
    • GALNT11 antibody
    • GLT11_HUMAN antibody
    • MGC71630 antibody
    • Polypeptide GalNAc transferase 11 antibody
    • Polypeptide N-acetylgalactosaminyltransferase 11 antibody
    • pp-GaNTase 11 antibody
    • Protein-UDP acetylgalactosaminyltransferase 11 antibody
    • tcag7.1057 antibody
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11 antibody
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) antibody
    see all

Images

  • Paraffin-embedded human gastric cancer tissue stained for GALNT11 using ab234713 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GALNT11 (green) using ab234713 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human cervical cancer tissue stained for GALNT11 using ab234713 at 1/100 dilution in immunohistochemical analysis.

References

ab234713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up