Overview

  • Product name
  • Description
    Rabbit polyclonal to GALNT9
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human GALNT9 aa 1-247. Isoform 2
    Sequence:

    MEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAW NIPMSNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYG EVRNSKASAYCLDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGS TAFLPDSKCLVDDGTGRMPTLKKCEDVARPTQRLWDFTQSGPIVSRATGR CLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHARH


    Database link: NP_068580.2

  • Positive control
    • GALNT9 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Does not glycosylate apomucin or SDC3.
  • Tissue specificity
    Specifically expressed in brain. Not expressed in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte. In brain, it is expressed in cerebellum, frontal lobe, temporal lobe, putamen and spinal cord, weakly expressed in cerebral cortex. Not expressed in medulla and occipital pole.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GalNAc T9 antibody
    • GalNAc transferase 9 antibody
    • GalNAc-T9 antibody
    • GALNT9 antibody
    • GALT9_HUMAN antibody
    • Polypeptide GalNAc transferase 9 antibody
    • Polypeptide N acetylgalactosaminyltransferase 9 antibody
    • Polypeptide N-acetylgalactosaminyltransferase 9 antibody
    • pp GaNTase 9 antibody
    • pp-GaNTase 9 antibody
    • Protein UDP acetylgalactosaminyltransferase 9 antibody
    • Protein-UDP acetylgalactosaminyltransferase 9 antibody
    • UDP GalNAc polypeptide N acetylgalactosaminyltransferase 9 antibody
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9 antibody
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9 (GalNAc-T9) antibody
    see all

Images

  • All lanes : Anti-GALNT9 antibody (ab172528) at 1 µg/ml

    Lane 1 : GALNT9 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µg/ml per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/2500 dilution

    Predicted band size: 68 kDa

References

ab172528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up