Overview

  • Product name

  • Description

    Rabbit polyclonal to GALT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GALT aa 1-379.
    Sequence:

    MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMK RPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFP ALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLPLMSVPEIRAV VDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQ REERSQQAYKSQHGEPLLMEYSRQELLRKERLVLTSEHWLVLVPFWATWP YQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGW HGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLT PEQAAERLRALPEVHYHLGQKDRETATIA


    Database link: P07902

  • Positive control

    • WB: Mouse small intestine and kidney lysates; rat liver lysate. IP: HepG2 whole cell lysate. IHC-P: Human tonsil and adrenal gland tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 43 kDa.

Target

  • Pathway

    Carbohydrate metabolism; galactose metabolism.
  • Involvement in disease

    Defects in GALT are the cause of galactosemia (GALCT) [MIM:230400]. Galactosemia is an inherited disorder of galactose metabolism that causes jaundice, cataracts, and mental retardation.
  • Sequence similarities

    Belongs to the galactose-1-phosphate uridylyltransferase type 1 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gal 1 P uridylyltransferase antibody
    • Gal-1-P uridylyltransferase antibody
    • Galactose 1 phosphate uridyl transferase antibody
    • Galactose 1 phosphate uridylyltransferase antibody
    • Galactose-1-phosphate uridylyltransferase antibody
    • GALT antibody
    • GALT_HUMAN antibody
    • UDP glucose hexose 1 phosphate uridylyltransferase antibody
    • UDP-glucose--hexose-1-phosphate uridylyltransferase antibody
    see all

Images

  • Anti-GALT antibody (ab237805) at 1/500 dilution + Mouse small intestine lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 43 kDa

  • All lanes : Anti-GALT antibody (ab237805) at 1/500 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human tonsil tissue stained for GALT using ab237805 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for GALT using ab237805 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GALT (green) using ab237805 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • GALT was immunoprecipitated from 0.5 mg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab237805 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP in HepG2 whole cell lysate.

    Lane 2: ab237805 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 10 μg (Input).

    For western blotting, a HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab237805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up