Overview

  • Product name

  • Description

    Rabbit polyclonal to gamma Actin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human gamma Actin aa 140-361. (BC012050).
    Sequence:

    LSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYL MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDI RKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV WIGGSILASLSTFQQMWISKQE


    Database link: P63261

  • Positive control

    • A549, HeLa and NIH3T3 cell lysates; Human fetal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab199406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 42 kDa.

Target

Images

  • All lanes : Anti-gamma Actin antibody (ab199406) at 1/1000 dilution

    Lane 1 : NIH3T3 cell lysate
    Lane 2 : A549 cell lysate
    Lane 3 : HeLa cell lysate

    Predicted band size: 42 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal muscle tissue labeling gamma Actin with ab199406 at 1/100 dilution.

References

This product has been referenced in:

  • Qiao Y  et al. Oxidized-low density lipoprotein accumulates cholesterol esters via the PKCa-adipophilin-ACAT1 pathway in RAW264.7 cells. Mol Med Rep 12:3599-3606 (2015). Read more (PubMed: 26017812) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up